PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr023945.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family NF-YB
Protein Properties Length: 199aa    MW: 21405 Da    PI: 8.3135
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr023945.1genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB176.82.2e-5532125194
        NF-YB   1 vreqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrele 94 
                  vreqdr+lPian+srimkk+lP+n+ki+kdak+tvqecvsefisfvtseasdkcq+ekrktingddllwa+atlGfedy+epl++yl++yre +
  Pbr023945.1  32 VREQDRYLPIANISRIMKKALPTNGKIAKDAKDTVQECVSEFISFVTSEASDKCQKEKRKTINGDDLLWAMATLGFEDYIEPLRIYLSRYREGD 125
                  69*****************************************************************************************965 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.102.3E-5229128IPR009072Histone-fold
SuperFamilySSF471137.3E-3935129IPR009072Histone-fold
PfamPF008083.4E-2838102IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006159.2E-216684No hitNo description
PROSITE patternPS0068506985IPR003956Transcription factor, NFYB/HAP3, conserved site
PRINTSPR006159.2E-2185103No hitNo description
PRINTSPR006159.2E-21104122No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 199 aa     Download sequence    Send to blast
MAEAPTSPAG GSHESGGEQS PQRGGGGGGS SVREQDRYLP IANISRIMKK ALPTNGKIAK  60
DAKDTVQECV SEFISFVTSE ASDKCQKEKR KTINGDDLLW AMATLGFEDY IEPLRIYLSR  120
YREGDAKGSA RGGDGSFKGN AVPAMPGPSS QFVHQGALNY GNPQPGFVLC TKYRPYISLG  180
ESNKMQHFSH VEKTCLMH*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4g92_B2e-4732123192Transcription factor HapC (Eurofung)
4g91_B2e-4732123192Transcription factor HapC (Eurofung)
4csr_A2e-4731123294NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
4awl_B2e-4731123294NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009333746.11e-112PREDICTED: nuclear transcription factor Y subunit B-1-like
SwissprotQ8VYK42e-73NFYB8_ARATH; Nuclear transcription factor Y subunit B-8
TrEMBLA0A067E1386e-94A0A067E138_CITSI; Uncharacterized protein
TrEMBLM5XKX89e-94M5XKX8_PRUPE; Uncharacterized protein
STRINGPOPTR_0008s04440.19e-90(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF25453382
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38880.75e-66nuclear factor Y, subunit B1